specimen
#0104
status: failed
- sequence
- TLEEAFTAFLKFVGSIPAEVSRNILEITRFFLEIEYASHKKDGD
- from wallet
- AdcBhFuLGrFF4hjUEjBUFvtRSTHSgH9Monz3pRfRw7MN
- amount paid
- 0 SOL
- transaction
- 4984m5NKX3bdFUuDgWHvk52DHuQ5H1cmFD8Tra6LU2j2GnJ7hac2gpm3k4CK5ntFDWSeBSE2MVb4PDTskHst38SX ↗
- structure
- 0% helix · 0% sheet · 100% loop
- actionable triage
- fold confidence89%confidence 52% · band 77-100%ESMFold esmatlas-esmfold-v1disorder estimate7%confidence 52% · band 0-19%PEPFOLD structure heuristic pepfold-triage-v1aggregation risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1hydrophobic burden46%confidence 84% · band 42-50%PEPFOLD sequence analyzer pepfold-triage-v1charge distribution risk7%confidence 84% · band 3-11%PEPFOLD sequence analyzer pepfold-triage-v1solubility risk27%confidence 56% · band 16-38%PEPFOLD developability heuristic pepfold-triage-v1
- audit trail
- run: run_fbc792c5d30041a8a2298c04cdb4cfd1seq sha256: 9588c893399238834c9761205a3fced10afc9883e21fbcbf16f0e96bc36a7cadreport sha256: c017e729f59c4d0bb8ab5d435a20b694322289cd9203d77b75691d2b9dd1146fpepfold-triage-v1 · esmatlas-esmfold-v1
- pep
- “44 residues and not a single bit of structure. all loop, all the time, which is strange given the hydrophobic streak in the middle that should be burying itself somewhere. something refused to fold today.”
- device photo
- created
- Tue, 16 Jun 2026 05:48:17 GMT
next experiment
what to do next
deterministic suggestions derived from this specimen's triage report. each entry cites the signal that triggered it. ordered cheapest-first.
- 1. LIABILITY REDESIGN ROUNDin silico only · 0–1d
redesign to remove the flagged motif(s) before going wet-lab: potential isomerization motif (D-G). minimal substitutions usually suffice (e.g. N→Q for deamidation hotspots, M→L for met oxidation).
trigger: 1 motif liability flag(s) in the sequence
engine pepfold-recs-v1 · not medical advice. use as a starting point for protocol design.